PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G01330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 352aa    MW: 39584.2 Da    PI: 7.1575
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G01330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.7e-48141471128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtd e++ +yL +k  + +++    i+evd++k+ePwdLp +++ +++ewy Fs++d ky+tg r+nratk+gyWkatgkd+e+++
  OGLUM11G01330.1  14 LPPGFRFHPTDAEVILNYLLEKFINPSFTS-LPIHEVDLNKCEPWDLP-TARMGNNEWY-FSRKDMKYPTGMRTNRATKEGYWKATGKDREIFK 104
                      79**********************999888.56***************.4455777885.7999****************************** PP

              NAM  95 k.........kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                +++lvg+kktLvfy grapkg++t+Wvmhe+rl
  OGLUM11G01330.1 105 PaiyegssknNKQLVGMKKTLVFYMGRAPKGTRTNWVMHEFRL 147
                      99999999887888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-5410173IPR003441NAC domain
PROSITE profilePS5100550.1514173IPR003441NAC domain
PfamPF023655.8E-2315147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MVEPVKSELG SLFLPPGFRF HPTDAEVILN YLLEKFINPS FTSLPIHEVD LNKCEPWDLP  60
TARMGNNEWY FSRKDMKYPT GMRTNRATKE GYWKATGKDR EIFKPAIYEG SSKNNKQLVG  120
MKKTLVFYMG RAPKGTRTNW VMHEFRLHAN LHNHYPNLRL NPNEWVVCKV FHKKQGDEAI  180
NNQQQQPAVD QADDDDIFQL DDIFAYPSIY DFSNSSANIL SAPPNNNAVH SSVSAGTTMT  240
STTTASSFQH QPNCYSAPLQ QHVSSWNNTP GAGGAHGIGS SYYNLQQQQQ QQAAMVKDLE  300
DIIAVPDYGT LLPSSNKGSS IRSAMAGVSQ QNPLGVPQYK IENYGDHYIS RE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-43917412166NO APICAL MERISTEM PROTEIN
1ut4_B3e-43917412166NO APICAL MERISTEM PROTEIN
1ut7_A3e-43917412166NO APICAL MERISTEM PROTEIN
1ut7_B3e-43917412166NO APICAL MERISTEM PROTEIN
3swm_A3e-43917415169NAC domain-containing protein 19
3swm_B3e-43917415169NAC domain-containing protein 19
3swm_C3e-43917415169NAC domain-containing protein 19
3swm_D3e-43917415169NAC domain-containing protein 19
3swp_A3e-43917415169NAC domain-containing protein 19
3swp_B3e-43917415169NAC domain-containing protein 19
3swp_C3e-43917415169NAC domain-containing protein 19
3swp_D3e-43917415169NAC domain-containing protein 19
4dul_A3e-43917412166NAC domain-containing protein 19
4dul_B3e-43917412166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235190.0AC123519.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0017B18, complete sequence.
GenBankAC1235250.0AC123525.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0056E15, complete sequence.
GenBankAK2882710.0AK288271.1 Oryza sativa Japonica Group cDNA, clone: J090017A22, full insert sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616089.10.0PREDICTED: NAC domain-containing protein 77-like
SwissprotQ5CD170.0NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLA0A0E0BES70.0A0A0E0BES7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034714-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51203063
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-64Arabidopsis NAC domain containing protein 87